Hummus rainbow wraps

Make these colourful rainbow wraps, with hummus, beetroot, carrot, feta and baby spinach for a quick and easy veggie lunch for the whole family

lunchcarrotsfamily-friendlysandwichesspinachwraps

0

Prep Time: 15 minutes

Total Time: 15 minutes

Nutritional Information

Calories:286 kcal

Carbohydrate:40 g

Fat:8 g

Dietary Fiber:9 g

Protein:9 g

Saturated Fat:2 g

Sodium:1 mg

Sugar:14 g

Ingredients

Instructions

Step 1
Spread the wraps with the hummus, then fill with the carrot, beetroot, spinach and feta, for those who want it. Wrap and save for lunchtime or eat straightaway.

Community Notes

No notes yet. Be the first to share your experience.