Blueberry cheesecake pancakes

Try these moreish blueberry cheesecake pancakes on Shrove Tuesday, they'll go down a storm with the family. They also make a lovely dessert all year round

View original recipe on bbcgoodfood.com

brunchdessertcheesecakefamily-friendlypancakes

0

Prep Time: 10 minutes

Cook Time: 10 minutes

Total Time: 20 minutes

Servings: 4

Nutritional Information

Calories:390 kcal

Carbohydrate:35 g

Fat:22 g

Dietary Fiber:2 g

Protein:10 g

Saturated Fat:7 g

Sodium:0.4 mg

Sugar:15 g

Ingredients

150g fresh or frozen blueberries

1 tbsp maple syrup

100g cream cheese

1/2 -1 tbsp icing sugar to taste

4 pancakes or crêpes (see recipe, below)

4 caramelised biscuits or ginger nuts, crushed

50g nuts (pecans or almonds work well), roughly chopped or crushed (optional)

Instructions

Step 1
Simmer the blueberries and maple syrup over a low heat until soft and syrupy, this should take about 3 mins.
Step 2
Mix the cream cheese and icing sugar to taste. When the pancakes are cooked, top with blueberries, sweetened cream cheese, crushed biscuits and nuts.

Community Notes

No notes yet. Be the first to share your experience.