Cheese, Marmite & spinach pinwheels

Make these easy pinwheels with cheddar, Marmite and spinach flavours to serve with soup or as part of a family picnic. Freeze before baking, if you prefer

View original recipe on bbcgoodfood.com

lunchsnackfamily-friendlyspinach

0

Prep Time: 5 minutes

Cook Time: 20 minutes

Total Time: 25 minutes

Servings: 12

Nutritional Information

Calories:136 kcal

Carbohydrate:9 g

Fat:9 g

Dietary Fiber:1 g

Protein:4 g

Saturated Fat:5 g

Sodium:0.5 mg

Sugar:0.4 g

Ingredients

320g sheet ready-rolled light puff pastry

1 tbsp Marmite

2-3 large handfuls of spinach

80g cheddar

Instructions

Step 1
Heat the oven to 200C/180C fan/ gas 6. Unroll the pastry with the longer side directly in front of you. Spread the Marmite over the surface. Tear the spinach over the Marmite and scatter with the cheese, making sure it’s evenly spread.
Step 2
Tightly roll the pastry away from you (starting from the longer side) to create a long sausage shape, then cut into 12 pieces. Arrange over two baking trays lined with baking parchment, spiral side up, and squash down a little with your hand. Will keep covered and frozen at this stage. Bake for 15-20 mins (or 25 mins if cooking from frozen), until puffed and golden brown.

Community Notes

No notes yet. Be the first to share your experience.